"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0S2SQD2"	"{'domain_architectures': 681, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 681}"	"['Capsid protein self-assembles to form rod-shaped virions about 18 nm in diameter with a central canal enclosing the viral genomic RNA']"	"CP"	"[{'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019028', 'name': 'viral capsid', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A0S2SQD2_9VIRU"	"f7e9d877d5b2963f5991f584a79c6fad9c277821"	False	True	161	"Capsid protein"	2	""	"MAYNPITPSKLIAFSASYVPVRTLLNFLVASQGTAFQTQAGRDSFRESLSALPSSVVDINSRFPDAGFYAFLNGPVLRPIFVSLLSSTDTRNRVIEVVDPSNPTTAESLNAVKRTDDASTAARAEIDNLIESISKGFDVYDRASFEAAFSVVWSEATTSKA"	"unreviewed"	"{'taxId': '12235', 'scientificName': 'Cucumber green mottle mosaic virus', 'fullName': 'Cucumber green mottle mosaic virus'}"