GET /api/protein/UniProt/A0A0D3RLV3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D3RLV3",
        "id": "A0A0D3RLV3_9VIRU",
        "source_organism": {
            "taxId": "263004",
            "scientificName": "Sweet potato chlorotic fleck virus",
            "fullName": "Sweet potato chlorotic fleck virus"
        },
        "name": "Movement protein TGBp3",
        "description": [
            "Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata. May induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments"
        ],
        "length": 67,
        "sequence": "MPPLWVTALIGFLLCLMTVVYIDSIRVVPSECLIVITKSSITIRSCKQIPDLSELKTFNLSGVDCTL",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "a69303c0375ecc317a2e98969cc884266e447026",
        "counters": {
            "domain_architectures": 1283,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1283
        }
    }
}