GET /api/protein/UniProt/A0A0D3RLV3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0D3RLV3",
"id": "A0A0D3RLV3_9VIRU",
"source_organism": {
"taxId": "263004",
"scientificName": "Sweet potato chlorotic fleck virus",
"fullName": "Sweet potato chlorotic fleck virus"
},
"name": "Movement protein TGBp3",
"description": [
"Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata. May induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments"
],
"length": 67,
"sequence": "MPPLWVTALIGFLLCLMTVVYIDSIRVVPSECLIVITKSSITIRSCKQIPDLSELKTFNLSGVDCTL",
"proteome": null,
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "a69303c0375ecc317a2e98969cc884266e447026",
"counters": {
"domain_architectures": 1283,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1283
}
}
}