"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0D3RLV3"	"{'domain_architectures': 1283, 'entries': 2, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 1283}"	"['Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata. May induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments']"	""	""	"A0A0D3RLV3_9VIRU"	"a69303c0375ecc317a2e98969cc884266e447026"	False	False	False	67	"Movement protein TGBp3"	3	""	"MPPLWVTALIGFLLCLMTVVYIDSIRVVPSECLIVITKSSITIRSCKQIPDLSELKTFNLSGVDCTL"	"unreviewed"	"{'taxId': '263004', 'scientificName': 'Sweet potato chlorotic fleck virus', 'fullName': 'Sweet potato chlorotic fleck virus'}"