General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A096P3J4",
        "id": "A0A096P3J4_PAPAN",
        "source_organism": {
            "taxId": "9555",
            "scientificName": "Papio anubis",
            "fullName": "Papio anubis (Olive baboon)"
        },
        "name": "S-acyl fatty acid synthase thioesterase, medium chain",
        "description": [
            "Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16)"
        ],
        "length": 265,
        "sequence": "MDRGDQAKRTRNENVFNCLYKNPEANFKLICFPWAGGGSVHFAKWGQDTHDSLEVHSLRLPGRESRIEEPFANDISQLVDEVVCALQPVIQDKQFAFFGHSMGSYIAFRTALHLKENNKPEPLHLFLSSATPIHSKAWPRIPKEDELSEEQISHYLTEFGGTPKDFVEDKELVKQYSPMIRADLSLVSSCTSNIPSKAVLSCDLTCFVGSEDIAKDVEAWKDVTSGNTNIHQLPGDHFYLLDPANERLIKNYVIKCLEVSSLANF",
        "proteome": "UP000028761",
        "gene": "OLAH",
        "go_terms": [
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e88c114adfca26f396ffde454d4b7c6018bf9a6c",
        "counters": {
            "domain_architectures": 18424,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18424
        }
    }
}