"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A096P3J4"	"{'domain_architectures': 13931, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 13931}"	"['Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16)']"	""	"[{'identifier': 'GO:0009058', 'name': 'biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A096P3J4_PAPAN"	"e88c114adfca26f396ffde454d4b7c6018bf9a6c"	True	False	265	"S-acyl fatty acid synthase thioesterase, medium chain"	3	"UP000028761"	"MDRGDQAKRTRNENVFNCLYKNPEANFKLICFPWAGGGSVHFAKWGQDTHDSLEVHSLRLPGRESRIEEPFANDISQLVDEVVCALQPVIQDKQFAFFGHSMGSYIAFRTALHLKENNKPEPLHLFLSSATPIHSKAWPRIPKEDELSEEQISHYLTEFGGTPKDFVEDKELVKQYSPMIRADLSLVSSCTSNIPSKAVLSCDLTCFVGSEDIAKDVEAWKDVTSGNTNIHQLPGDHFYLLDPANERLIKNYVIKCLEVSSLANF"	"unreviewed"	"{'taxId': '9555', 'scientificName': 'Papio anubis', 'fullName': 'Papio anubis (Olive baboon)'}"