HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A091IIC6",
"id": "A0A091IIC6_CALAN",
"source_organism": {
"taxId": "9244",
"scientificName": "Calypte anna",
"fullName": "Calypte anna (Anna's hummingbird)"
},
"name": "Dual specificity mitogen-activated protein kinase kinase 5",
"description": [
"Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac development and angiogenesis. As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM"
],
"length": 438,
"sequence": "SRAMESQALVIRIRIPDGGAVDWTVHSAPQLLFRDVLDVIGQVLPDATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIYPRACKPPGKRNIHGLKVNTRAGAANNSSSAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDILGHGNGGTVYKAYHVPSGKILAVKVIPLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISLCTEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEESPVLPAGEFSEPFVHFITQCMKKQPKERPAPEDLMGHPFIVQYNDGNAEVVSMWVCRMLEERRSTQG",
"proteome": "UP000054308",
"gene": "N300_05575",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7a179ec1a11ca99520405944c9c43a044671b035",
"counters": {
"domain_architectures": 3895,
"entries": 24,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 3,
"cdd": 2,
"smart": 2,
"profile": 2,
"pfam": 2,
"panther": 1,
"prosite": 2,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3895
}
}
}