GET /api/protein/UniProt/A0A091IIC6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091IIC6",
        "id": "A0A091IIC6_CALAN",
        "source_organism": {
            "taxId": "9244",
            "scientificName": "Calypte anna",
            "fullName": "Calypte anna (Anna's hummingbird)"
        },
        "name": "Dual specificity mitogen-activated protein kinase kinase 5",
        "description": [
            "Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac development and angiogenesis. As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM"
        ],
        "length": 438,
        "sequence": "SRAMESQALVIRIRIPDGGAVDWTVHSAPQLLFRDVLDVIGQVLPDATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIYPRACKPPGKRNIHGLKVNTRAGAANNSSSAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDILGHGNGGTVYKAYHVPSGKILAVKVIPLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISLCTEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEESPVLPAGEFSEPFVHFITQCMKKQPKERPAPEDLMGHPFIVQYNDGNAEVVSMWVCRMLEERRSTQG",
        "proteome": "UP000054308",
        "gene": "N300_05575",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7a179ec1a11ca99520405944c9c43a044671b035",
        "counters": {
            "domain_architectures": 3895,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 3,
                "cdd": 2,
                "smart": 2,
                "profile": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 2,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3895
        }
    }
}