GET /api/protein/UniProt/A0A091DNF3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091DNF3",
        "id": "A0A091DNF3_FUKDA",
        "source_organism": {
            "taxId": "885580",
            "scientificName": "Fukomys damarensis",
            "fullName": "Fukomys damarensis (Damaraland mole rat)"
        },
        "name": "B9 domain-containing protein 2",
        "description": [
            "Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes"
        ],
        "length": 175,
        "sequence": "MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQVGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVRLELGLLLRHFDRYGVEC",
        "proteome": "UP000028990",
        "gene": "H920_05000",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4f5bc55abc4fa213138b9c0a009d722284d0dc89",
        "counters": {
            "domain_architectures": 5503,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5503
        }
    }
}