"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A091DNF3"	"{'domain_architectures': 5503, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5503}"	"['Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes']"	"H920_05000"	""	"A0A091DNF3_FUKDA"	"4f5bc55abc4fa213138b9c0a009d722284d0dc89"	True	False	False	175	"B9 domain-containing protein 2"	3	"UP000028990"	"MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQVGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVRLELGLLLRHFDRYGVEC"	"unreviewed"	"{'taxId': '885580', 'scientificName': 'Fukomys damarensis', 'fullName': 'Fukomys damarensis (Damaraland mole rat)'}"