General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A080WR92",
        "id": "A0A080WR92_TRIRC",
        "source_organism": {
            "taxId": "559305",
            "scientificName": "Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)",
            "fullName": "Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus)"
        },
        "name": "V-type proton ATPase proteolipid subunit",
        "description": [
            "Proton-conducting pore forming of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments",
            "Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments"
        ],
        "length": 193,
        "sequence": "MAESELAPKFAPFIGMAGIASAIIFGCVGAAYGTAKAGIGIAGVGTFRPDLIMKSLIPVVMAGIIAVYGLVVAVLIAGDLGPPPETQYSLYAGCLHLAAGLSVGLAGLAAGYTIGIVGEAVSCATTALLDPVLKKRCLGNTRVYATVQGVCRNGLDIDFWRSPGSIWFDCWSDSKLEEFCIDVLHFSRTFAVV",
        "proteome": "UP000008864",
        "gene": "TERG_07868",
        "go_terms": [
            {
                "identifier": "GO:0015078",
                "name": "proton transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0033177",
                "name": "proton-transporting two-sector ATPase complex, proton-transporting domain",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0046961",
                "name": "proton-transporting ATPase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033179",
                "name": "proton-transporting V-type ATPase, V0 domain",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0c91cd7e80ef1f8ea234c0ac103454bbd7aff98",
        "counters": {
            "domain_architectures": 49652,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49652
        }
    }
}