HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A080WR92",
"id": "A0A080WR92_TRIRC",
"source_organism": {
"taxId": "559305",
"scientificName": "Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)",
"fullName": "Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus)"
},
"name": "V-type proton ATPase proteolipid subunit",
"description": [
"Proton-conducting pore forming of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments",
"Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments"
],
"length": 193,
"sequence": "MAESELAPKFAPFIGMAGIASAIIFGCVGAAYGTAKAGIGIAGVGTFRPDLIMKSLIPVVMAGIIAVYGLVVAVLIAGDLGPPPETQYSLYAGCLHLAAGLSVGLAGLAAGYTIGIVGEAVSCATTALLDPVLKKRCLGNTRVYATVQGVCRNGLDIDFWRSPGSIWFDCWSDSKLEEFCIDVLHFSRTFAVV",
"proteome": "UP000008864",
"gene": "TERG_07868",
"go_terms": [
{
"identifier": "GO:0015078",
"name": "proton transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033177",
"name": "proton-transporting two-sector ATPase complex, proton-transporting domain",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0046961",
"name": "proton-transporting ATPase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033179",
"name": "proton-transporting V-type ATPase, V0 domain",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d0c91cd7e80ef1f8ea234c0ac103454bbd7aff98",
"counters": {
"domain_architectures": 49652,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 49652
}
}
}