"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A080WR92"	"{'domain_architectures': 49652, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'ncbifam': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 49652}"	"['Proton-conducting pore forming of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments', 'Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments']"	"TERG_07868"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033177', 'name': 'proton-transporting two-sector ATPase complex, proton-transporting domain', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0046961', 'name': 'proton-transporting ATPase activity, rotational mechanism', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0033179', 'name': 'proton-transporting V-type ATPase, V0 domain', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A080WR92_TRIRC"	"d0c91cd7e80ef1f8ea234c0ac103454bbd7aff98"	True	False	False	193	"V-type proton ATPase proteolipid subunit"	3	"UP000008864"	"MAESELAPKFAPFIGMAGIASAIIFGCVGAAYGTAKAGIGIAGVGTFRPDLIMKSLIPVVMAGIIAVYGLVVAVLIAGDLGPPPETQYSLYAGCLHLAAGLSVGLAGLAAGYTIGIVGEAVSCATTALLDPVLKKRCLGNTRVYATVQGVCRNGLDIDFWRSPGSIWFDCWSDSKLEEFCIDVLHFSRTFAVV"	"unreviewed"	"{'taxId': '559305', 'scientificName': 'Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)', 'fullName': ""Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus)""}"
