› › F-actin-capping protein subunit beta isoforms 1 and 2

F-actin-capping protein subunit beta isoforms 1 and 2 in PDB entry 7dsa, assembly 1, front view.
F-actin-capping protein subunit beta isoforms 1 and 2 in PDB entry 7dsa, assembly 1, side view.
F-actin-capping protein subunit beta isoforms 1 and 2 in PDB entry 7dsa, assembly 1, top view.
Chain: B
Length: 244 amino acids
Theoretical weight: 27.47 KDa
Source organism: Gallus gallus
Expression system: Escherichia coli
UniProt:
  • Canonical: P14315 (Residues: 1-244; Coverage: 88%)
Gene name: CAPZB
FASTA Sequence
>pdb|7dsa|B
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
PDBe-KB: UniProt Coverage View: P14315  

Quick links

Search similar proteins