PDBe-KB: UniProt Coverage View:
O95167
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 in PDB entry 5xtd, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5xtd_entity_19_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5xtd</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 in PDB entry 5xtd, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5xtd_entity_19_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5xtd</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 in PDB entry 5xtd, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5xtd_entity_19_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5xtd</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3</span>. Top view.")
Chain: U
Length: 83 amino acids
Theoretical weight: 9.16 KDa
Source organism: Homo sapiens
UniProt:
FASTA Sequence
Length: 83 amino acids
Theoretical weight: 9.16 KDa
Source organism: Homo sapiens
UniProt:
- Canonical: O95167 (Residues: 2-84; Coverage: 99%)
FASTA Sequence
>pdb|5xtd|U
AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
PDBe-KB: UniProt Coverage View:
O95167