› › SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 in PDB entry 5gjk, assembly 1, front view.
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 in PDB entry 5gjk, assembly 1, side view.
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 in PDB entry 5gjk, assembly 1, top view.
Chain: B
Length: 68 amino acids
Theoretical weight: 7.8 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q12824 (Residues: 183-249; Coverage: 17%)
Gene names: BAF47, INI1, SMARCB1, SNF5L1
FASTA Sequence
>pdb|5gjk|B
APEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYP
PDBe-KB: UniProt Coverage View: Q12824  

Quick links

Search similar proteins