› › Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial in PDB entry 1zwv, assembly 1, front view.
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial in PDB entry 1zwv, assembly 1, side view.
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial in PDB entry 1zwv, assembly 1, top view.
Chain: A
Length: 58 amino acids
Theoretical weight: 6.64 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P11182 (Residues: 165-215; Coverage: 11%)
Gene names: BCATE2, BCKDHE2, DBT
FASTA Sequence
>pdb|1zwv|A
GEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTLEHHHHHH
PDBe-KB: UniProt Coverage View: P11182  

Quick links

Search similar proteins