HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W9XJX4",
"id": "W9XJX4_9EURO",
"source_organism": {
"taxId": "1182542",
"scientificName": "Capronia epimyces CBS 606.96",
"fullName": "Capronia epimyces CBS 606.96"
},
"name": "H/ACA ribonucleoprotein complex subunit 2",
"description": [
"Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs",
"Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ('psi') residues may serve to stabilize the conformation of rRNAs"
],
"length": 126,
"sequence": "MADNPSAAWPLADEALSQSIYDLVQQASHYRQLKKGANEATKTLNRGTAEIIVLAADTTPLAILLHLPLLAEDKNVPYVYVPSRVALGRACGVSRSVIAASITTNEGSDLTPQIRALKDKVERLMI",
"proteome": "UP000019478",
"gene": "A1O3_09879",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042254",
"name": "ribosome biogenesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1990904",
"name": "ribonucleoprotein complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005730",
"name": "nucleolus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e648c895252343045e836caf4ce7bf2296aeba99",
"counters": {
"domain_architectures": 43462,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 43462
}
}
}