General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W6ZEX0",
        "id": "W6ZEX0_COCMI",
        "source_organism": {
            "taxId": "930090",
            "scientificName": "Bipolaris oryzae ATCC 44560",
            "fullName": "Bipolaris oryzae ATCC 44560"
        },
        "name": "Putative glutathione-dependent formaldehyde-activating enzyme",
        "description": [
            "Catalyzes the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione"
        ],
        "length": 192,
        "sequence": "MASISIHPAIDNGIKKGNPNFPGGKLYCHCPSDKVEVTLSSNVAHNHACGCSKCWKPRGALFSVVGVLPKDNVSVTANGHKLHIIDESAAIQRNACKECGVHLFGRIVNDHPFKGLDFVHTELSNTSGWQEPQFAAFVSSIIEQGFNPAQMDAVREKFRSVGLQSYDVLSPQLMDLIATYTAQKNGKLPAKL",
        "proteome": "UP000054032",
        "gene": "COCMIDRAFT_86974",
        "go_terms": [
            {
                "identifier": "GO:0016846",
                "name": "carbon-sulfur lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051907",
                "name": "S-(hydroxymethyl)glutathione synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046294",
                "name": "formaldehyde catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f53e8ff1ef85b3cc97f8086658caeb43b265bdbb",
        "counters": {
            "domain_architectures": 46168,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 46168
        }
    }
}