GET /api/protein/unreviewed/V6SPV5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V6SPV5",
        "id": "V6SPV5_9FLAO",
        "source_organism": {
            "taxId": "1341181",
            "scientificName": "Flavobacterium limnosediminis JC2902",
            "fullName": "Flavobacterium limnosediminis JC2902"
        },
        "name": "Coenzyme A biosynthesis bifunctional protein CoaBC",
        "description": [
            "Catalyzes two sequential steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine. In the second step the latter compound is decarboxylated to form 4'-phosphopantotheine",
            "Catalyzes two steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine, in the latter compound is decarboxylated to form 4'-phosphopantotheine"
        ],
        "length": 402,
        "sequence": "MSVLSGKKVLLGVSGGIAAYKTATLVRLLIKAGAQVQVIMTPASKDFVTPLTLSTLSKNPVYSTFSNEEGAEAEWNNHVEFGLWADLMLIAPATANTLSKMVNGNCDNLLIATYLSAKCPVYFAPAMDLDMYKHPSTVDSFKALSEFGNIMIPAESGELASGLSGEGRMAEPENIIVFLEKDIESKLPLKGRKILVTAGPTYEAIDPVRFIGNHSTGKMGFDIAKAAADLGAEVILVSGPTHLQLKHALVNVIRVTSAQEMYDVCHQYFNGVDAAVAAAAVADYRPKNVASQKIKKNDAAFSIELEKTKDILASLGEIKQQQFLIGFALETENEIEHAKQKIQKKNLDLIVLNSLNDEGAGFGKATNKVTFIDKNFSIEPMDLKSKEEVAQDIVNKIVKQYA",
        "proteome": "UP000018004",
        "gene": "coaBC",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004632",
                "name": "phosphopantothenate--cysteine ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004633",
                "name": "phosphopantothenoylcysteine decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015937",
                "name": "coenzyme A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015941",
                "name": "pantothenate catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ae56f16f585a747ec4bcf527a1a938b2bbf62363",
        "counters": {
            "domain_architectures": 23529,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23529
        }
    }
}