General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V5FU28",
        "id": "V5FU28_ANOGL",
        "source_organism": {
            "taxId": "217634",
            "scientificName": "Anoplophora glabripennis",
            "fullName": "Anoplophora glabripennis (Asian longhorn beetle)"
        },
        "name": "Telomeric repeat-binding factor 2-interacting protein 1",
        "description": [
            "Acts both as a regulator of telomere function and as a transcription regulator. Involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). Does not bind DNA directly: recruited to telomeric double-stranded 5'-TTAGGG-3' repeats via its interaction with terf2. Independently of its function in telomeres, also acts as a transcription regulator: recruited to extratelomeric 5'-TTAGGG-3' sites via its association with terf2 or other factors, and regulates gene expression"
        ],
        "length": 115,
        "sequence": "MSGYRPIYTADEDTIILKFIIATQSYYQIRGKSLWEDMANSGLIDRTWMSLKERFDKHILPRINDSRFDLSATGKKHIELGHYQLSLKIDDVDEDDDSGAEISVDSDSDEEDTKN",
        "proteome": null,
        "gene": "TE2IP",
        "go_terms": [
            {
                "identifier": "GO:0000723",
                "name": "telomere maintenance",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bc0cd45f7c4654e874dd1c29507bb78fb07a474a",
        "counters": {
            "domain_architectures": 792,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 792
        }
    }
}