General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U7PV93",
        "id": "U7PV93_SPOS1",
        "source_organism": {
            "taxId": "1391915",
            "scientificName": "Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183)",
            "fullName": "Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus)"
        },
        "name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1",
        "description": [
            "Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER)"
        ],
        "length": 474,
        "sequence": "MKLLASVLSLLAAAVSVVQAVSASGPRLLAVLDDLADKDTYSTFLGDLEGRGFSVSYETAKSSTVSLFRLGERAYDHVIFFPTKAKGLGPNLTPQLLVQFLNAEGNILVALSSANAASSSIVSLLSELDISLPSDRTGLVVDHVNYDSLAAADHHDVLLLPVPAARSGIKSLFDTPASASGEQLLAFPRGVGHVLGDSPYLAPIVSAPRTAYSYNPQEQADAVSGGPDSELFASGAQLKLVSGLQARNSARFALLGSAELLSNTWFDAKVKLPAAGAKTVPTYNREFARRLAGWTFQETGVLRVNWIEHHLNEHGASNASNPEIYRVKNDVAYAISVSEHAWDAWTPFTVPAGDELQIEFSMLSPFHRLPLHVVPAQATDDATVYAAHFTLPDQHGIFNFLVDYKRPFLTYLDEKITVSVRHMAHDEWPRSYVISGAWPWITGIGATVTGWLAFCALWMYSKPTGQVAVGKKTQ",
        "proteome": "UP000018087",
        "gene": "HMPREF1624_04704",
        "go_terms": [
            {
                "identifier": "GO:0006487",
                "name": "protein N-linked glycosylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4d21a3a090e01091f1107c3587b47176f7b21591",
        "counters": {
            "domain_architectures": 4436,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4436
        }
    }
}