General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S7ZI41",
        "id": "S7ZI41_PENO1",
        "source_organism": {
            "taxId": "933388",
            "scientificName": "Penicillium oxalicum (strain 114-2 / CGMCC 5302)",
            "fullName": "Penicillium oxalicum (strain 114-2 / CGMCC 5302)"
        },
        "name": "D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein",
        "description": null,
        "length": 344,
        "sequence": "MSPKLRFAILDDYQGIARPHFAHLEDRVDIVCFPKTLDPHIPAEQEALVKRLKTFDVILAMRERTPFAASTIAALPNLKLLLTTGTRNLALDLDAFTQQGIAVAGTEGRPPGVNATVQHTWALILGLARHLARDDAAIKAGGWQGTLGMGLSGKTLGLLGLGKLGSQVGKIAVQAFGMRVVAWSTNLSQEKADEQARAQDLAPGSFLVAPSKAEFFTQSDIVSIHSVLSDRSRGIVGAEDLARMKPHSLIINTSRGPLIDEPALLEALQTGHIRGAALDVFDREPLPLNSPWRTTPWGQGGRSEVLLSPHMGYGEEDLLHGWYEEVAENLERWLNGEELLRRLN",
        "proteome": "UP000019376",
        "gene": "PDE_03282",
        "go_terms": [
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2639c8cd154653da624aa289b601553afa089052",
        "counters": {
            "domain_architectures": 104541,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 104541
        }
    }
}