GET /api/protein/unreviewed/S7MVG8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S7MVG8",
"id": "S7MVG8_MYOBR",
"source_organism": {
"taxId": "109478",
"scientificName": "Myotis brandtii",
"fullName": "Myotis brandtii (Brandt's bat)"
},
"name": "Gamma-secretase subunit APH-1",
"description": [
"Potential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors"
],
"length": 247,
"sequence": "MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDPSDARLQYGLLIFGAAVSVLLQEMFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWTLGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSFSCKD",
"proteome": "UP000052978",
"gene": "D623_10031856",
"go_terms": [
{
"identifier": "GO:0016485",
"name": "protein processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043085",
"name": "positive regulation of catalytic activity",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "af84851eee3b0d24abe47b86a0182c47ae0b4d6a",
"counters": {
"domain_architectures": 3284,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3284
}
}
}