GET /api/protein/unreviewed/R1F2J4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R1F2J4",
"id": "R1F2J4_EMIHU",
"source_organism": {
"taxId": "2903",
"scientificName": "Emiliania huxleyi",
"fullName": "Emiliania huxleyi (Coccolithophore)"
},
"name": "Fatty acid desaturase domain-containing protein",
"description": null,
"length": 254,
"sequence": "YALLTFGITGGHHRYFSHRSYRTSRPFQFAIALLGSLAWQRGPIWWSSHHNHHHLHSDTGRDPHSPVTGSWLWSHMGWYWASAEHDPPLDKFARTWRSFPELAALDKLHFAPGLLLAASLYACGGGGALLWGFVVPVTCCWNSIFAIGSLCHGDLGGGTRRFETGGADTSTNVWWVAMLTLGDGWRPPPFLPSRRPSPPLPPTAASALARHNNHHAFRWSARQGLAAHELDATYAALRALETLGLVWDLKVPSA",
"proteome": null,
"gene": "EMIHUDRAFT_55852",
"go_terms": [
{
"identifier": "GO:0016717",
"name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b8c2738eb3d02f13bb1292f93a1ea49688306935",
"counters": {
"domain_architectures": 61909,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 61909
}
}
}