GET /api/protein/unreviewed/Q9XWG2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9XWG2",
"id": "Q9XWG2_CAEEL",
"source_organism": {
"taxId": "6239",
"scientificName": "Caenorhabditis elegans",
"fullName": "Caenorhabditis elegans"
},
"name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2",
"description": [
"Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
],
"length": 92,
"sequence": "MSVRLAGTALREIRIHVCQKSPASAGVRAFIENDYVGIKKANPQFPILIREASGIVPRVFARYEHGVERVATLEDLSRENVKSTITQLASQK",
"proteome": "UP000001940",
"gene": "ndua-2",
"go_terms": null,
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "852f0a5d90ec90df505ecc00a82e4bf1b3023bd6",
"counters": {
"domain_architectures": 10106,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10106
}
}
}