GET /api/protein/unreviewed/Q9L4Q9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9L4Q9",
"id": "Q9L4Q9_ACEST",
"source_organism": {
"taxId": "1511",
"scientificName": "Acetoanaerobium sticklandii",
"fullName": "Acetoanaerobium sticklandii"
},
"name": "Mini-ribonuclease 3",
"description": [
"Involved in correct processing of both the 5' and 3' ends of 23S rRNA precursor. Processes 30S rRNA precursor transcript even in absence of ribonuclease 3 (Rnc); Rnc processes 30S rRNA into smaller rRNA precursors"
],
"length": 119,
"sequence": "MGDAAYEDRVRAHVIRKCPTLKVNDLHKEAVKYVKASAQAYAVLELMKQEQLSEDEVSVVKRGRNHASNAPKNANVAEYKYATGFEALLGYLYFSSLTDRMEEIIDESIKLINNCLTSK",
"proteome": null,
"gene": "mrnC",
"go_terms": [
{
"identifier": "GO:0004525",
"name": "ribonuclease III activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dfc8314b2419b8f58c92ee55d44d4f321c59044c",
"counters": {
"domain_architectures": 9655,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9655
}
}
}