GET /api/protein/unreviewed/Q9L4Q9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9L4Q9",
        "id": "Q9L4Q9_ACEST",
        "source_organism": {
            "taxId": "1511",
            "scientificName": "Acetoanaerobium sticklandii",
            "fullName": "Acetoanaerobium sticklandii"
        },
        "name": "Mini-ribonuclease 3",
        "description": [
            "Involved in correct processing of both the 5' and 3' ends of 23S rRNA precursor. Processes 30S rRNA precursor transcript even in absence of ribonuclease 3 (Rnc); Rnc processes 30S rRNA into smaller rRNA precursors"
        ],
        "length": 119,
        "sequence": "MGDAAYEDRVRAHVIRKCPTLKVNDLHKEAVKYVKASAQAYAVLELMKQEQLSEDEVSVVKRGRNHASNAPKNANVAEYKYATGFEALLGYLYFSSLTDRMEEIIDESIKLINNCLTSK",
        "proteome": null,
        "gene": "mrnC",
        "go_terms": [
            {
                "identifier": "GO:0004525",
                "name": "ribonuclease III activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dfc8314b2419b8f58c92ee55d44d4f321c59044c",
        "counters": {
            "domain_architectures": 9655,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9655
        }
    }
}