HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9KV61",
"id": "Q9KV61_VIBCH",
"source_organism": {
"taxId": "243277",
"scientificName": "Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)",
"fullName": "Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)"
},
"name": "Biotin carboxyl carrier protein of acetyl-CoA carboxylase",
"description": [
"This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA"
],
"length": 196,
"sequence": "MRFRCPRLRIRFVCCNPSIAGQAIKTLCGPFGLSYSQDKRERNMDIRKIKKLIELVEESGIAELEISEGEESVRISRYGQPAPAPQVHYAAAPAPVAAPAPVAQAAAVAEAPAAAKVPAGHKVLSPMVGTFYRSPSPDAKAFIEVGQSVSVGDTLCIVEAMKMMNQIEADKSGVVTAILVEDGQTVEFDQPLVVIE",
"proteome": "UP000000584",
"gene": "VC_0296",
"go_terms": [
{
"identifier": "GO:0003989",
"name": "acetyl-CoA carboxylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009317",
"name": "acetyl-CoA carboxylase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dd0c5330318796f2fa156b62a4fc52353ee9b1f5",
"counters": {
"domain_architectures": 40308,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 40308
}
}
}