General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7SG25",
        "id": "Q7SG25_NEUCR",
        "source_organism": {
            "taxId": "367110",
            "scientificName": "Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)",
            "fullName": "Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)"
        },
        "name": "DUF1687-domain-containing protein",
        "description": [
            "Putative mitochondrial redox protein which could be involved in the reduction of small toxic molecules"
        ],
        "length": 135,
        "sequence": "MFKFLQPKVLDTITLFHKASNPASIRIATLLKQAAGSGAAVSDNAPAKKSDFELNITEEAPTTEQLRTMLDYVGKTGISSIISNAQNETEALKKFKENGDNLNRPIVVDWNNGKVFTGDNESAILKLLEDLPKKN",
        "proteome": "UP000001805",
        "gene": "NCU02595",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cdb919886404d1736ab3353eb4a63fb4bce140ea",
        "counters": {
            "domain_architectures": 1500,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1500
        }
    }
}