General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q759A0",
        "id": "Q759A0_EREGS",
        "source_organism": {
            "taxId": "284811",
            "scientificName": "Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)",
            "fullName": "Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast)"
        },
        "name": "DNA-directed RNA polymerase subunit",
        "description": [
            "DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 292,
        "sequence": "MGVKKSPLKRSKTAEFINKHRKLCKNPISSEDNTSQCITRLPVSMYVSLAPLYQQHPLEGIKRQHLNPMVMKYNGDVGGVILGYENVAIMNEGAAKDEELLVKLTPDTPFAFTWCSVDLVVWSPHIGDVLEGWIFIQSASHIGLLIHDAFNASIKKNNIPDDWTFIHNEESTNGSSENDSSTGMRKARSLGHWVDGNGKQLDGKLKFTVKNVYTAGRMVSLEGSLLSEGYHRSQAENLPVVSNTKIIFDDEVSQENKESHKDLELSVLKEDNGDEIMYEKDSSDSNSDSDSD",
        "proteome": "UP000000591",
        "gene": "AGOS_ADR377W",
        "go_terms": [
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cbda45cd687a25ed0ae40f4ba9862a7caeb4a8bc",
        "counters": {
            "domain_architectures": 960,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 960
        }
    }
}