GET /api/protein/unreviewed/Q5IBC6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5IBC6",
"id": "Q5IBC6_MAIZE",
"source_organism": {
"taxId": "4577",
"scientificName": "Zea mays",
"fullName": "Zea mays (Maize)"
},
"name": "DANA2",
"description": [
"High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids"
],
"length": 223,
"sequence": "MKATLKGRYEGDKATAATTLAAPAGDLRLKASATEAAFTNGPSLRGLTLTLEKPGAFLVDLKPHNQDVRFQFMNSALVLDKRVSLTYTHSTSLAAAPAAAPPSRTALDCTVTFDPANKVSLSHSLGSGGCRLKYTYAHGVDRLTTIEPLFDTNKNAWEFAITRKFAGGDAVKGTYQASTKLLGLEWSRDSLAGGSFKVATTFDLSDQSKAPKLIAESTWNYEI",
"proteome": "UP000007305",
"gene": "LOC542205",
"go_terms": [
{
"identifier": "GO:0022843",
"name": "voltage-gated monoatomic cation channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0034765",
"name": "regulation of monoatomic ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e036151359b35fcdce730538b1e393030218d7e9",
"counters": {
"domain_architectures": 1001,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1001
}
}
}