General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5IBC6",
        "id": "Q5IBC6_MAIZE",
        "source_organism": {
            "taxId": "4577",
            "scientificName": "Zea mays",
            "fullName": "Zea mays (Maize)"
        },
        "name": "DANA2",
        "description": [
            "High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids"
        ],
        "length": 223,
        "sequence": "MKATLKGRYEGDKATAATTLAAPAGDLRLKASATEAAFTNGPSLRGLTLTLEKPGAFLVDLKPHNQDVRFQFMNSALVLDKRVSLTYTHSTSLAAAPAAAPPSRTALDCTVTFDPANKVSLSHSLGSGGCRLKYTYAHGVDRLTTIEPLFDTNKNAWEFAITRKFAGGDAVKGTYQASTKLLGLEWSRDSLAGGSFKVATTFDLSDQSKAPKLIAESTWNYEI",
        "proteome": "UP000007305",
        "gene": "LOC542205",
        "go_terms": [
            {
                "identifier": "GO:0022843",
                "name": "voltage-gated monoatomic cation channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034765",
                "name": "regulation of monoatomic ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e036151359b35fcdce730538b1e393030218d7e9",
        "counters": {
            "domain_architectures": 1001,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1001
        }
    }
}