GET /api/protein/unreviewed/Q2S240/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2S240",
"id": "Q2S240_SALRD",
"source_organism": {
"taxId": "309807",
"scientificName": "Salinibacter ruber (strain DSM 13855 / M31)",
"fullName": "Salinibacter ruber (strain DSM 13855 / M31)"
},
"name": "N5-carboxyaminoimidazole ribonucleotide mutase",
"description": [
"Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR)"
],
"length": 170,
"sequence": "MSTSSAPPVGIAMGSDSDLPVMEDAAEVLDEFDVSYEMRVLSAHRTPGVMKEYAETAQERGVEVMIAGAGGAAHLPGMLAASTPLPVIGVPVKTSTMNGVDSLLSIVQMPGGVPVGSVAINAADNAALLAVQILGVQDPDLRAEMTAYKDDLTETVEEMDERVSDRSSDR",
"proteome": "UP000008674",
"gene": "purE",
"go_terms": [
{
"identifier": "GO:0006189",
"name": "'de novo' IMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d89d356d1d1613dc6b1f42931173ab2f367d689a",
"counters": {
"domain_architectures": 29691,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29691
}
}
}