GET /api/protein/unreviewed/Q18CE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q18CE6",
"id": "Q18CE6_CLOD6",
"source_organism": {
"taxId": "272563",
"scientificName": "Clostridioides difficile (strain 630)",
"fullName": "Clostridioides difficile (strain 630)"
},
"name": "Transcription termination/antitermination protein NusG",
"description": [
"Participates in transcription elongation, termination and antitermination"
],
"length": 180,
"sequence": "MSELQEASWYVVHTYSGHENKVKATIEKAVKTRGMEDCIRQVVVPTEEVVETTKTGKEKTRQRKVYPSYVLVKMIITDESWYVVRNTKGVTGFVGPGSKPVPLSEDEVKAMGIDTTDPKVVNSDIDFEIGDTVKVSQGPFSGQIGNIEEIDLENREVKVCINAFGKRTLFVIELEGIEKI",
"proteome": null,
"gene": "nusG",
"go_terms": [
{
"identifier": "GO:0006354",
"name": "DNA-templated transcription elongation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0032784",
"name": "regulation of DNA-templated transcription elongation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ccd38e675d74451c747a85b020117e4056b2906f",
"counters": {
"domain_architectures": 16712,
"entries": 22,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 2,
"ssf": 2,
"pfam": 2,
"cdd": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 16712
}
}
}