GET /api/protein/unreviewed/M6GW44/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M6GW44",
"id": "M6GW44_LEPIR",
"source_organism": {
"taxId": "1001590",
"scientificName": "Leptospira interrogans str. 2006001854",
"fullName": "Leptospira interrogans str. 2006001854"
},
"name": "Putative membrane protein insertion efficiency factor",
"description": [
"Could be involved in insertion of integral membrane proteins into the membrane"
],
"length": 74,
"sequence": "MNRFVIQLIQLYKRLLSPLLPPACRFTPTCSEYAAQAFQEYGFFRALQLSIWRILRCNPLSRGFDDPLPPNTKG",
"proteome": null,
"gene": "LEP1GSC037_2445",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4da36602f37f1ac9db3f86e3c42e5a968fdfe864",
"counters": {
"domain_architectures": 23104,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 23104
}
}
}