General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M6GW44",
        "id": "M6GW44_LEPIR",
        "source_organism": {
            "taxId": "1001590",
            "scientificName": "Leptospira interrogans str. 2006001854",
            "fullName": "Leptospira interrogans str. 2006001854"
        },
        "name": "Putative membrane protein insertion efficiency factor",
        "description": [
            "Could be involved in insertion of integral membrane proteins into the membrane"
        ],
        "length": 74,
        "sequence": "MNRFVIQLIQLYKRLLSPLLPPACRFTPTCSEYAAQAFQEYGFFRALQLSIWRILRCNPLSRGFDDPLPPNTKG",
        "proteome": null,
        "gene": "LEP1GSC037_2445",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4da36602f37f1ac9db3f86e3c42e5a968fdfe864",
        "counters": {
            "domain_architectures": 23104,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 23104
        }
    }
}