General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L7IXA4",
        "id": "L7IXA4_PYRO1",
        "source_organism": {
            "taxId": "1143193",
            "scientificName": "Pyricularia oryzae (strain P131)",
            "fullName": "Pyricularia oryzae (strain P131) (Rice blast fungus)"
        },
        "name": "DNA replication complex GINS protein SLD5",
        "description": [
            "The GINS complex plays an essential role in the initiation of DNA replication. Has a role in chromosome segregation"
        ],
        "length": 221,
        "sequence": "MEIDDILREVDPDFDALPSERRDLQLLTRAWVAERSAPELLEWPSDGLFERVNDRIKQQIEHVEDMTGNMDPKTNFALIVIQTELERYKFLVRSYLRARMAKIDKHTLHYLSTPSLRSRLSGTELAYATRHQALLHNHYLSSFLASFPPALQNLNDTAGNISMIDTPDLDSAVFIRLLRDAFVEGKGTDSDGAMEGRDGDILILRWSDAKHLVDEGNAELV",
        "proteome": null,
        "gene": "OOW_P131scaffold01287g70",
        "go_terms": [
            {
                "identifier": "GO:0006261",
                "name": "DNA-templated DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4833c1354e8addee0a144c48a541cdf1f74b2eb9",
        "counters": {
            "domain_architectures": 3226,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 2,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3226
        }
    }
}