GET /api/protein/unreviewed/K7G041/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K7G041",
"id": "K7G041_PELSI",
"source_organism": {
"taxId": "13735",
"scientificName": "Pelodiscus sinensis",
"fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
},
"name": "Interleukin-2 receptor subunit alpha",
"description": [
"Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells"
],
"length": 165,
"sequence": "AGKCHAPDYIEFAEITIDKVMVGSKAQYECKPGYQRIVGESDFIVCKNDSEFIHWTMRTTICKRTKQGWAQSKTQALNFVSSEHSRIFMSPAPLTRAFNSCYCGMPMPVEYATAKVTEYAVGQELHYKCLSGYDTRPPTSGIRTCKEENGKIFWTSLHLQCTNDS",
"proteome": "UP000007267",
"gene": null,
"go_terms": [
{
"identifier": "GO:0004911",
"name": "interleukin-2 receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019976",
"name": "interleukin-2 binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "12d720c9eb5480a153462998968e7da3ac85b69b",
"counters": {
"domain_architectures": 4243,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"cdd": 1,
"cathgene3d": 2,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4243
}
}
}