GET /api/protein/unreviewed/K7G041/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K7G041",
        "id": "K7G041_PELSI",
        "source_organism": {
            "taxId": "13735",
            "scientificName": "Pelodiscus sinensis",
            "fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
        },
        "name": "Interleukin-2 receptor subunit alpha",
        "description": [
            "Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells"
        ],
        "length": 165,
        "sequence": "AGKCHAPDYIEFAEITIDKVMVGSKAQYECKPGYQRIVGESDFIVCKNDSEFIHWTMRTTICKRTKQGWAQSKTQALNFVSSEHSRIFMSPAPLTRAFNSCYCGMPMPVEYATAKVTEYAVGQELHYKCLSGYDTRPPTSGIRTCKEENGKIFWTSLHLQCTNDS",
        "proteome": "UP000007267",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004911",
                "name": "interleukin-2 receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019976",
                "name": "interleukin-2 binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "12d720c9eb5480a153462998968e7da3ac85b69b",
        "counters": {
            "domain_architectures": 4243,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4243
        }
    }
}