HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3M5U0",
"id": "I3M5U0_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "Elongation of very long chain fatty acids protein 7",
"description": [
"Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate to the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators"
],
"length": 281,
"sequence": "MAFSDLTSRTVRFYDNFIKDADPRVEDWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKVMITYNFCIVLFSLYMCYEFVMSGWGTGYSFQCEIVDYSRSPTALRMAHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFVNTAVHVVMYFYYGLCAMGPAYQKYLWWKKYLTSLQLVQFVIVTIHIGQIFFMEDCKYQFPVFLYIIMSYGFIFLLLFLHFWYRAYTKGQRLPKSVNNGNCKNKHH",
"proteome": "UP000005215",
"gene": "ELOVL7",
"go_terms": [
{
"identifier": "GO:0009922",
"name": "fatty acid elongase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019367",
"name": "fatty acid elongation, saturated fatty acid",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042761",
"name": "very long-chain fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005783",
"name": "endoplasmic reticulum",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "726b44df556ad17af08cf1eeb76a7efce6e198bf",
"counters": {
"domain_architectures": 25966,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25966
}
}
}