GET /api/protein/unreviewed/H9HA00/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H9HA00",
"id": "H9HA00_NOMLE",
"source_organism": {
"taxId": "61853",
"scientificName": "Nomascus leucogenys",
"fullName": "Nomascus leucogenys (Northern white-cheeked gibbon)"
},
"name": "GTP cyclohydrolase 1 feedback regulatory protein",
"description": [
"Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine"
],
"length": 84,
"sequence": "MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRVLGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE",
"proteome": "UP000001073",
"gene": "GCHFR",
"go_terms": [
{
"identifier": "GO:0009890",
"name": "negative regulation of biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f704602afe400354975abaaf0141f4e35a6aa5a0",
"counters": {
"domain_architectures": 1117,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1117
}
}
}