GET /api/protein/unreviewed/H3ADK7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H3ADK7",
        "id": "H3ADK7_LATCH",
        "source_organism": {
            "taxId": "7897",
            "scientificName": "Latimeria chalumnae",
            "fullName": "Latimeria chalumnae (Coelacanth)"
        },
        "name": "Transcription factor Spi-C",
        "description": [
            "Controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. Transcription factor that binds to the PU-box, a purine-rich DNA sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. Regulates VCAM1 gene expression"
        ],
        "length": 95,
        "sequence": "EKKIRLFQFLFDMLEDPKMKHCISWVQPSSGIFQFSSQNKENLAKIWGIRKGNRKTMTYQKMARALRNYSKTGEIRKVKHKLTYQFSDSVLKTLK",
        "proteome": "UP000008672",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006357",
                "name": "regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9be233735550f087463761b543470356402b2953",
        "counters": {
            "domain_architectures": 15296,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "smart": 1,
                "cathgene3d": 1,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15296
        }
    }
}