General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H3A632",
        "id": "H3A632_LATCH",
        "source_organism": {
            "taxId": "7897",
            "scientificName": "Latimeria chalumnae",
            "fullName": "Latimeria chalumnae (Coelacanth)"
        },
        "name": "CDGSH iron-sulfur domain-containing protein 2",
        "description": [
            "Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy"
        ],
        "length": 132,
        "sequence": "ADYLNSISAILSLSLPAPPQPKKIHSFLSVLSVSEWLRLLPFLGVLALLGYLAIRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLHLTKAYCRCWRSKTFPVCDGSHNKHNELTGDNIGPLIIKKKEV",
        "proteome": "UP000008672",
        "gene": "CISD2",
        "go_terms": [
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043231",
                "name": "intracellular membrane-bounded organelle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0010506",
                "name": "regulation of autophagy",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d4861801147e08b4abf000e38e11d6376d03acb",
        "counters": {
            "domain_architectures": 1942,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "smart": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1942
        }
    }
}