General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2LDW9",
        "id": "H2LDW9_ORYLA",
        "source_organism": {
            "taxId": "8090",
            "scientificName": "Oryzias latipes",
            "fullName": "Oryzias latipes (Japanese rice fish)"
        },
        "name": "Esterase OVCA2",
        "description": [
            "Exhibits ester hydrolase activity with a strong preference for long-chain alkyl ester substrates and high selectivity against a variety of short, branched, and substituted esters. Is able to hydrolyze ester bonds within a wide range of p-nitrophenyl derivatives (C2-C14) in vitro, with a strong preference toward substrates of >8 carbons"
        ],
        "length": 223,
        "sequence": "MAPLRILCIHGYRQNGNTFREKTGALRKLLKKQVELVYMSAPLSVQKEGSEEVCNAETGSGAGGEEDPRGWWFSDTQARSFNALQQCDESLGLEESVSAVKEAVKAHGPFDGILGFSQGAAFVAMLCCLQEQKPEPDFTFRFAVLVAGFRSLCKEHEKFYSTTLQIPSLHVFGLEDRVIPDHMSRDLLPSFQDPQVLIHPGGHFVPAASAHRQTYQDFLKKFQ",
        "proteome": "UP000001038",
        "gene": "OVCA2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2efb0fae7d9869eeeabf9dd5447d5d24ed070a34",
        "counters": {
            "domain_architectures": 12299,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12299
        }
    }
}