General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G9NBG5",
        "id": "G9NBG5_HYPVG",
        "source_organism": {
            "taxId": "413071",
            "scientificName": "Hypocrea virens (strain Gv29-8 / FGSC 10586)",
            "fullName": "Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens)"
        },
        "name": "3-oxo-5-alpha-steroid 4-dehydrogenase C-terminal domain-containing protein",
        "description": null,
        "length": 292,
        "sequence": "MALIEGLFPPSRENYELLLQCWQIGYPVIGSMQWIIKWYGMGKTSVSSIFNIPGRLAWMTMECPGFLTLLYVMNTLPQKAGIDDLPWQNRVLGGLFVIHYSYRAVLFPLIQPSMSPIHVGVWALAIGFQLCNALCISSWLSAYGPTTAEAWSSVSSIPQFILGIGIFYLGLSSNFFHDEELREIRRREQKRQERIRQQSGDKTGSAASVEKHYQIPQAGLFRYMLYPHYLSEWVEWFGFYMAAGWGCAPARAFLVNEIFSMLPRAVNGKKWYIERFGEEKIGKKWAVIPGIW",
        "proteome": "UP000007115",
        "gene": "TRIVIDRAFT_39209",
        "go_terms": [
            {
                "identifier": "GO:0003865",
                "name": "3-oxo-5-alpha-steroid 4-dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008202",
                "name": "steroid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "83497c29bd6d1f02a8b71c3bbb2f32b82f98b659",
        "counters": {
            "domain_architectures": 420,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 420
        }
    }
}