HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G9NAE4",
"id": "G9NAE4_HYPVG",
"source_organism": {
"taxId": "413071",
"scientificName": "Hypocrea virens (strain Gv29-8 / FGSC 10586)",
"fullName": "Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens)"
},
"name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively"
],
"length": 151,
"sequence": "MSGAGSGDATLFEESFTVTEYDQSKYDRVARISCTSSDSQTVMTLDINIELFPCSVSDTLHVVLTTTLSPDGTKEDDKGWRDVGKAGDAPATLADLYDYVCYGKIYKFEETFDGNTINAYVSFGGLLMQLQGPVKKLTPLRVDNVYLLVKR",
"proteome": "UP000007115",
"gene": "TRIVIDRAFT_184264",
"go_terms": [
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "370c379e323b06b4097a2b7b6aa86a00b38755e7",
"counters": {
"domain_architectures": 4640,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"ssf": 1,
"cathgene3d": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4640
}
}
}