GET /api/protein/unreviewed/G8ZMX6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8ZMX6",
"id": "G8ZMX6_TORDE",
"source_organism": {
"taxId": "4950",
"scientificName": "Torulaspora delbrueckii",
"fullName": "Torulaspora delbrueckii (Yeast)"
},
"name": "Autophagy-related protein 29",
"description": [
"Plays a role in autophagy. Functions at the preautophagosomal structure (PAS) in order to form normal autophagosomes under starvation conditions. Also plays a role in mitophagy and regulation of filamentous growth"
],
"length": 196,
"sequence": "MNNSNTVVYVKVKGNRPAGFVDPAPFEWNVEKEKHLWAIVSKLDNYQDQIDWNVLSKTLEAPDYFLKKRSYKLFAMHLKLLEQQIERKMMASDNENGSRQTSIQQFEPTGGIHTLTESCMKIQGPAQDDLTDVTKETTLKTLQQLHTSKILNRSRHLTSDDKEVRRNGNASDSETSSSLSVSTSALEEALMDRLQL",
"proteome": "UP000005627",
"gene": "TDEL0A06380",
"go_terms": [
{
"identifier": "GO:0000045",
"name": "autophagosome assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "24160b27d088f6dd65342cb58e0690d1cfe177d4",
"counters": {
"domain_architectures": 1193,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1193
}
}
}