GET /api/protein/unreviewed/G5EFU2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G5EFU2",
        "id": "G5EFU2_CAEEL",
        "source_organism": {
            "taxId": "6239",
            "scientificName": "Caenorhabditis elegans",
            "fullName": "Caenorhabditis elegans"
        },
        "name": "ADP/ATP translocase",
        "description": [
            "ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane",
            "Catalyzes the exchange of ADP and ATP across the membrane"
        ],
        "length": 313,
        "sequence": "MSGGGDSKPIDKKKEDKKGFDTRKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASLTIAADKRYKGIVDVLVRVPKEQGYAALWRGNLANVIRYFPTQALNFAFKDTYKNIFQKGLDKKKDFWKFFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKANEREFKGLADCLVKIAKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMVFTADGKKLNFFAAWAIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDVLYKNTLDCAVKIIKNEGMSAMFKGALSNVFRGTGGALVLAIYDEIQKFI",
        "proteome": "UP000001940",
        "gene": "ant-1.4",
        "go_terms": [
            {
                "identifier": "GO:0005471",
                "name": "ATP:ADP antiporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140021",
                "name": "mitochondrial ADP transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1990544",
                "name": "mitochondrial ATP transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005743",
                "name": "mitochondrial inner membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}