GET /api/protein/unreviewed/G3Y2S9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3Y2S9",
"id": "G3Y2S9_ASPNA",
"source_organism": {
"taxId": "380704",
"scientificName": "Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)",
"fullName": "Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)"
},
"name": "Mitochondrial import inner membrane translocase subunit",
"description": [
"Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins"
],
"length": 93,
"sequence": "MGIFGGSSSPSTDASSKEVKEALFKQVQAESAMSNARTLITNVNEHCFEACVPTPGTTMSAGEQACLTDCMEKYIAFWNTVSRTYTRRVGTEQ",
"proteome": null,
"gene": "ASPNIDRAFT_206719",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9178374a5901be0d54a7f9dfe55ffbddb0efa3a",
"counters": {
"domain_architectures": 17178,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17178
}
}
}