General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3Y2S9",
        "id": "G3Y2S9_ASPNA",
        "source_organism": {
            "taxId": "380704",
            "scientificName": "Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)",
            "fullName": "Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)"
        },
        "name": "Mitochondrial import inner membrane translocase subunit",
        "description": [
            "Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins"
        ],
        "length": 93,
        "sequence": "MGIFGGSSSPSTDASSKEVKEALFKQVQAESAMSNARTLITNVNEHCFEACVPTPGTTMSAGEQACLTDCMEKYIAFWNTVSRTYTRRVGTEQ",
        "proteome": null,
        "gene": "ASPNIDRAFT_206719",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f9178374a5901be0d54a7f9dfe55ffbddb0efa3a",
        "counters": {
            "domain_architectures": 17178,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 17178
        }
    }
}