HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3SWG8",
"id": "G3SWG8_LOXAF",
"source_organism": {
"taxId": "9785",
"scientificName": "Loxodonta africana",
"fullName": "Loxodonta africana (African elephant)"
},
"name": "Microsomal glutathione S-transferase 2",
"description": [
"Catalyzes several different glutathione-dependent reactions. Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE. Has glutathione transferase activity, toward xenobiotic electrophiles, such as 1-chloro-2, 4-dinitrobenzene (CDNB). Catalyzes also the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4). Involved in oxidative DNA damage induced by ER stress and anticancer agents by activating LTC4 biosynthetic machinery in nonimmune cells"
],
"length": 147,
"sequence": "MAGNSILLAAVSLLSAFQQSYFAFQVGKARLKYKVTPPAVTGSPDFERVFRAQQNCVEFYPVFMLAFWMAGWYFNQALASFLGLVYMYARHQYFFGYSEAVKKRVTGFRLSLVVLALLTFLGTLGIANSFLDEYLDLNIAKKLRWHL",
"proteome": "UP000007646",
"gene": "MGST2",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0008047",
"name": "enzyme activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006691",
"name": "leukotriene metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e2cf1f5163a84e238f4e7981be2ccc606dab93d5",
"counters": {
"domain_architectures": 28012,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28012
}
}
}