GET /api/protein/unreviewed/G3AMD4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3AMD4",
"id": "G3AMD4_SPAPN",
"source_organism": {
"taxId": "619300",
"scientificName": "Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)",
"fullName": "Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)"
},
"name": "Uncharacterized protein",
"description": [
"Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum"
],
"length": 78,
"sequence": "MSAPDIPKSVIQKLVFFTGAMIILPVFTFFVCQYLFNHNSIISGGIAALIANVVLIGYVVVAFTEDTSKLEEESKKEI",
"proteome": "UP000000709",
"gene": "SPAPADRAFT_60134",
"go_terms": [
{
"identifier": "GO:0070072",
"name": "vacuolar proton-transporting V-type ATPase complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "179986e03afdcbedde8c358346371e5bb95ab699",
"counters": {
"domain_architectures": 3865,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3865
}
}
}