HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G2XEU4",
"id": "G2XEU4_VERDV",
"source_organism": {
"taxId": "498257",
"scientificName": "Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137)",
"fullName": "Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)"
},
"name": "U1 small nuclear ribonucleoprotein C",
"description": [
"Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region"
],
"length": 179,
"sequence": "MSVRKAHNSGRNHLRNVVYYYQQIGHEKAQSVIDSITSSYAAEGQAHANPMLPQNQPGQGFPPPPFPFPGGIPPPGFPGAPPFPQGMIPPPGPPGRGMPPLPFPPPGANCAPMPPPGGLPFPPPGGLPFPPPGAAGAGGLPPNFPPFPGMPGAPPGGFPGGPPPPPGGGFPGAPGQDRR",
"proteome": "UP000001611",
"gene": "VDAG_08679",
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030627",
"name": "pre-mRNA 5'-splice site binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000395",
"name": "mRNA 5'-splice site recognition",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000398",
"name": "mRNA splicing, via spliceosome",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005685",
"name": "U1 snRNP",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b3d4a988413dcb14e72275512e7fed5e9885436e",
"counters": {
"domain_architectures": 6436,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6436
}
}
}
