General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G2R505",
        "id": "G2R505_THETT",
        "source_organism": {
            "taxId": "578455",
            "scientificName": "Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126)",
            "fullName": "Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126)"
        },
        "name": "Biogenesis of lysosome-related organelles complex 1 subunit CNL1",
        "description": [
            "Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1), a complex that is involved in endosomal cargo sorting"
        ],
        "length": 187,
        "sequence": "MSQQQQDASNAVPDTQLGLTEDEIQLLRHGQQAVAAAGGSTSSRAASRASSQGLLMVDTSSLTALGRHFDRVMQSIQQRLDYLMQQSEIVTLSVYDRAGNLIDNADAEIARYHEIMAQIDELELDFDRISHIREIVHGFRQRAEELERELERAGGGSSSRRERHGHGPGHSSHRSHGHSSSSGKRRT",
        "proteome": "UP000008181",
        "gene": "THITE_2112133",
        "go_terms": [
            {
                "identifier": "GO:0031083",
                "name": "BLOC-1 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}