GET /api/protein/unreviewed/G1RKY1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1RKY1",
        "id": "G1RKY1_NOMLE",
        "source_organism": {
            "taxId": "61853",
            "scientificName": "Nomascus leucogenys",
            "fullName": "Nomascus leucogenys (Northern white-cheeked gibbon)"
        },
        "name": "Orexin",
        "description": [
            "Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested",
            "Binds to orexin receptor HCRTR2/OX2R only. Stimulates food intake. Modulates pituitary luteinizing hormone secretion in an ovarian steroid-dependent manner",
            "Binds to orexin receptors HCRTR1/OX1R and HCRTR2/OX2R with a high affinity. Stimulates food intake. Modulates pituitary luteinizing hormone secretion in an ovarian steroid-dependent manner"
        ],
        "length": 131,
        "sequence": "MNLPSTKVSWAAVTLLLLLLLLPPALLSPGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCPAPAAASVAPGGRSGI",
        "proteome": "UP000001073",
        "gene": "HCRT",
        "go_terms": [
            {
                "identifier": "GO:0007218",
                "name": "neuropeptide signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007631",
                "name": "feeding behavior",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dca24cccc4eb231d5553f7fc6ca7e4690ea79e62",
        "counters": {
            "domain_architectures": 735,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "pirsf": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 735
        }
    }
}