GET /api/protein/unreviewed/F6XQT7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6XQT7",
"id": "F6XQT7_ORNAN",
"source_organism": {
"taxId": "9258",
"scientificName": "Ornithorhynchus anatinus",
"fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
},
"name": "Mitochondrial uncoupling protein 4",
"description": [
"Facilitates proton transport across the inner mitochondrial membrane and may dissipate excessive proton gradient associated with oxidative and metabolic stress at neuronal synapses. Regulates glutamate-induced proton conductance in astrocytes, shifting the energy metabolism toward aerobic glycolysis and lactate transfer to neurons for ATP synthesis. Can transport chloride ions with lower efficiency. The transport mechanism remains to be elucidated"
],
"length": 309,
"sequence": "MSPSKDEERRRSLAERWPGGSRFLLSCCAAVVAELATFPLDLTKTRLQIQGEAALARYGEPSGGSVPYRGMLRTAKGIVQEEGVLKLWQGVTPAIYRHLVYSGGRMVTYEYLRESVLGKSEDKHFPLWKAVMGGMIAGVIGQFFANPADLVKVQMQMEGKRKLEGKPSRFRGVHHAFAKILKEGGLRGLWAGWVPNVQRAALVNMGDLTTYDSVKHFLLRNTSLQDNILTHSLSSLCSGLVAATLGTPADVIKSRIMNQPTDKQGRGLLYKSSIDCLIQTIKGEGFMSLYKGFVPSWMRMRTRKADHQN",
"proteome": "UP000002279",
"gene": "SLC25A27",
"go_terms": [
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}