GET /api/protein/unreviewed/F2E947/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F2E947",
"id": "F2E947_HORVV",
"source_organism": {
"taxId": "112509",
"scientificName": "Hordeum vulgare subsp. vulgare",
"fullName": "Hordeum vulgare subsp. vulgare (Domesticated barley)"
},
"name": "GAGA-binding transcriptional activator",
"description": [
"Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes"
],
"length": 350,
"sequence": "MDDDGSLSIRNWGFYETMKGNLGLQLMPSVTGGHRDTKPLLPNGTFLQHHTPPHHPPHSHHPRDYGNGEPSGGMPAEPPAIHMDFVRNEAWMHPSQHQHQHQHQHQHQHQHQHQLQHQHQHQHSRELKVLNAVPVGPAPHIGHPGHAVHHHPTGFGMMPDARGAHTLQMMQPQEPPVPDEEKITPPLVEDHSVVGSKPPVKKRQQGRQPKVPKPKKPKKDATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR",
"proteome": "UP000011116",
"gene": "LOC123449207",
"go_terms": null,
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31c958846d46a2cc9bbb35cfb8689187b3acafee",
"counters": {
"domain_architectures": 3056,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"smart": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3056
}
}
}