GET /api/protein/unreviewed/F2E947/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F2E947",
        "id": "F2E947_HORVV",
        "source_organism": {
            "taxId": "112509",
            "scientificName": "Hordeum vulgare subsp. vulgare",
            "fullName": "Hordeum vulgare subsp. vulgare (Domesticated barley)"
        },
        "name": "GAGA-binding transcriptional activator",
        "description": [
            "Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes"
        ],
        "length": 350,
        "sequence": "MDDDGSLSIRNWGFYETMKGNLGLQLMPSVTGGHRDTKPLLPNGTFLQHHTPPHHPPHSHHPRDYGNGEPSGGMPAEPPAIHMDFVRNEAWMHPSQHQHQHQHQHQHQHQHQHQLQHQHQHQHSRELKVLNAVPVGPAPHIGHPGHAVHHHPTGFGMMPDARGAHTLQMMQPQEPPVPDEEKITPPLVEDHSVVGSKPPVKKRQQGRQPKVPKPKKPKKDATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR",
        "proteome": "UP000011116",
        "gene": "LOC123449207",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "31c958846d46a2cc9bbb35cfb8689187b3acafee",
        "counters": {
            "domain_architectures": 3056,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3056
        }
    }
}